PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold05060-abinit-gene-0.3-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WOX
Protein Properties Length: 302aa    MW: 35204.1 Da    PI: 9.9018
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold05060-abinit-gene-0.3-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.66.7e-2173132357
                                                           --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHH CS
                                              Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRak 54 
                                                           +R+++t+eq+ +L+el++  +r+p+a++++++A+ l    +++ ++V++WFqN++a+
  augustus_masked-scaffold05060-abinit-gene-0.3-mRNA-1  73 SRWNPTPEQILVLQELYQHgTRTPTADQIQQIAAYLrrfgKVEGKNVFYWFQNHKAR 129
                                                           7*****************99************************************* PP

                                                           HHC CS
                                              Homeobox  55 ekk 57 
                                                           e++
  augustus_masked-scaffold05060-abinit-gene-0.3-mRNA-1 130 ERQ 132
                                                           *97 PP

2Wus_type_Homeobox113.79.1e-3772134365
                                     Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrka 59 
                                                           ++RW+PtpeQi +L+ely++G+rtP++++iq+i+a L+++Gk+e+kNVfyWFQN+ka
  augustus_masked-scaffold05060-abinit-gene-0.3-mRNA-1  72 SSRWNPTPEQILVLQELYQHGTRTPTADQIQQIAAYLRRFGKVEGKNVFYWFQNHKA 128
                                                           79******************************************************* PP

                                     Wus_type_Homeobox  60 Rerqkq 65 
                                                           Rerqk+
  augustus_masked-scaffold05060-abinit-gene-0.3-mRNA-1 129 RERQKR 134
                                                           ****95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.75468133IPR001356Homeobox domain
SuperFamilySSF466898.32E-1368138IPR009057Homeodomain-like
SMARTSM003896.6E-670137IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-873132IPR009057Homeodomain-like
PfamPF000461.5E-1873132IPR001356Homeobox domain
CDDcd000862.09E-574134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGYGDGKEFN VSNSFTGLKL RPLIPKPMSI SPILTPLYCD STHHTNLFSM NHHPAYVTQQ  60
IETNFNTKPL ASSRWNPTPE QILVLQELYQ HGTRTPTADQ IQQIAAYLRR FGKVEGKNVF  120
YWFQNHKARE RQKRRRELAS HLQVQQHDCN SLVKKEPVME RKVYKVEQTK KWAPLLNCRR  180
LIEESALVHR AAKAEKISLG RIQFEGRVSQ KRRTVERQAT SQDKEMAHVL SLREGFPDPE  240
DQRRKFKTLK LFPLYGDDHC DCDGNNIGFT EEDIKLVPNK TRDNELAPSQ YFEFLPLQNK  300
QS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002280774.23e-79PREDICTED: WUSCHEL-related homeobox 1
SwissprotQ6X7K01e-42WOX1_ARATH; WUSCHEL-related homeobox 1
TrEMBLA5BL141e-77A5BL14_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g05020.t011e-76(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.17e-44WUSCHEL related homeobox 1